Trees | Indices | Help |
---|
|
object --+ | Seq.Seq --+ | MEMEInstance
A class describing the instances of a MEME motif, and the data thereof.
|
|||
|
|||
|
|||
|
|||
|
|||
|
|||
|
|||
|
|||
|
|||
Inherited from Inherited from Inherited from |
|
|||
Inherited from |
|
Create a Seq object. Arguments:
You will typically use Bio.SeqIO to read in sequences from files as SeqRecord objects, whose sequence will be exposed as a Seq object via the seq property. However, will often want to create your own Seq objects directly: >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> my_seq = Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF", ... IUPAC.protein) >>> my_seq Seq('MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF', IUPACProtein()) >>> print my_seq MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF >>> my_seq.alphabet IUPACProtein()
|
Trees | Indices | Help |
---|
Generated by Epydoc 3.0.1 on Fri Nov 26 16:18:46 2010 | http://epydoc.sourceforge.net |